1.67 Rating by ClearWebStats
cybersecuritynordic.com is 7 years 2 months 1 week old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, cybersecuritynordic.com is SAFE to browse.
Get Custom Widget

Traffic Report of Cybersecuritynordic

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
17
Siteadvisor Rating
View cybersecuritynordic.com site advisor rating Not Applicable

Where is cybersecuritynordic.com server located?

Hosted IP Address:

77.86.189.241 View other site hosted with cybersecuritynordic.com

Hosted Country:

cybersecuritynordic.com hosted country FI cybersecuritynordic.com hosted country

Location Latitude:

60.1695

Location Longitude:

24.9354

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View cybersecuritynordic.com HTML resources

Homepage Links Analysis

Home - CyberSecurity Nordic

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 5
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 6
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.86.189.241)

ViherTek - 12.-14.10.2016 Messukeskus, Helsinki

cybersecuritynordic.com favicon - vihertek.fi

ViherTek on ympäristösuunnittelun, -rakentamisen ja -hoidon vuoden tärkein ammattitapahtuma.

View cybersecuritynordic.com Pagerank   cybersecuritynordic.com alexa rank Not Applicable   cybersecuritynordic.com website value $ 8.95

Kiinteistö 26. - 27.9.2017 Messukeskus Helsinki

cybersecuritynordic.com favicon - kiinteistomessut.fi

Kiinteistönhoidon, isännöinnin ja kiinteistöjen peruskorjauksen vuoden tärkein tapahtuma 26.-27.9.2017 Messukeskuksessa Helsingissä.

View cybersecuritynordic.com Pagerank   cybersecuritynordic.com alexa rank Not Applicable   cybersecuritynordic.com website value $ 8.95

FinnSec 26.-27.9.2017 Messukeskus Helsinki

cybersecuritynordic.com favicon - finnsec.fi

Pohjoismaiden suurin turvallisuusalan tapahtuma 26.-27.9.2017. Tapahtumassa kohtaavat alan päättäjät ja tekijät sekä yritysten turvallisuudesta vastaavat

View cybersecuritynordic.com Pagerank   cybersecuritynordic.com alexa rank Not Applicable   cybersecuritynordic.com website value $ 8.95

Hammaslääkäripäivät | Messukeskus | 24. - 26.11.2016

cybersecuritynordic.com favicon - hammaslaakaripaivatnayttely.fi

Suomen suurin hammaslääketieteen koulutustapahtuma ja näytttely. Kouluttaudu, kehity ja verkostoidu suun hoidon suurimmassa ammattitapahtumassa.

View cybersecuritynordic.com Pagerank   cybersecuritynordic.com alexa rank Not Applicable   cybersecuritynordic.com website value $ 8.95

Studia-messut | Messukeskus | 29. - 30.11.2016

cybersecuritynordic.com favicon - studiamessut.fi

Suomen suurin opiskelu- ja uratapahtuma Studia. Avoinna ti 29.11. klo 9–17, ke 30.11. klo 9–16. Tervetuloa!

View cybersecuritynordic.com Pagerank   cybersecuritynordic.com alexa rank Not Applicable   cybersecuritynordic.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 09 Apr 2017 14:09:46 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: ; rel=shortlink
X-UA-Compatible: IE=Edge
X-Varnish: 4291614 5784627
Age: 258
Via: 1.1 varnish-v4
X-Cache: cached
Content-Length: 37647
Accept-Ranges: bytes

Domain Information for cybersecuritynordic.com

Domain Registrar: TUCOWS DOMAINS INC. cybersecuritynordic.com registrar info
Registration Date: 2017-02-09 7 years 2 months 1 week ago
Last Modified: 2017-02-09 7 years 2 months 1 week ago
Expiration Date: 2018-02-09 6 years 2 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.mynebula.fi cybersecuritynordic.com name server information 217.30.180.225 cybersecuritynordic.com server is located in Finland Finland
ns2.mynebula.fi cybersecuritynordic.com name server information 217.30.182.225 cybersecuritynordic.com server is located in Finland Finland

DNS Record Analysis

Host Type TTL Extra
cybersecuritynordic.com A 3591 IP:77.86.189.241
cybersecuritynordic.com NS 3600 Target:ns2.mynebula.fi
cybersecuritynordic.com NS 3600 Target:ns1.mynebula.fi
cybersecuritynordic.com SOA 3600 MNAME:ns1.mynebula.fi
RNAME:hostmaster.mynebula.fi
Serial:1035000
Refresh:1800
Retry:600
Expire:86400

Similarly Ranked Websites to Cybersecuritynordic

Google

cybersecuritynordic.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View cybersecuritynordic.com Pagerank   Alexa rank for cybersecuritynordic.com 1   website value of cybersecuritynordic.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

cybersecuritynordic.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View cybersecuritynordic.com Pagerank   Alexa rank for cybersecuritynordic.com 1   website value of cybersecuritynordic.com $ 8,833,062,960.00

Gmail

cybersecuritynordic.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View cybersecuritynordic.com Pagerank   Alexa rank for cybersecuritynordic.com 1   website value of cybersecuritynordic.com $ 8,833,062,960.00

Android Apps on Google Play

cybersecuritynordic.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View cybersecuritynordic.com Pagerank   Alexa rank for cybersecuritynordic.com 1   website value of cybersecuritynordic.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

cybersecuritynordic.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View cybersecuritynordic.com Pagerank   Alexa rank for cybersecuritynordic.com 1   website value of cybersecuritynordic.com $ 8,833,062,960.00

Full WHOIS Lookup for cybersecuritynordic.com

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: CYBERSECURITYNORDIC.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.MYNEBULA.FI
Name Server: NS2.MYNEBULA.FI
Status: ok https://icann.org/epp#ok
Updated Date: 09-feb-2017
Creation Date: 09-feb-2017
Expiration Date: 09-feb-2018

>>> Last update of whois database: Sun, 09 Apr 2017 14:14:04 GMT