1.67 Rating by ClearWebStats

cybersecuritynordic.com has registered 11 months 1 week ago. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, cybersecuritynordic.com is SAFE to browse.

Get Custom Widget

Traffic Report for cybersecuritynordic.com

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Where is cybersecuritynordic.com server located?

Hosted IP Address:

Hosted Country:

Finland FI

Location Latitude:


Location Longitude:

cybersecuritynordic.com search engine traffic

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

Home - CyberSecurity Nordic

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 5
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 6
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

ViherTek - 12.-14.10.2016 Messukeskus, Helsinki

- vihertek.fi

ViherTek on ympäristösuunnittelun, -rakentamisen ja -hoidon vuoden tärkein ammattitapahtuma.

  Not Applicable   $ 8.95

Kiinteistö 26. - 27.9.2017 Messukeskus Helsinki

- kiinteistomessut.fi

Kiinteistönhoidon, isännöinnin ja kiinteistöjen peruskorjauksen vuoden tärkein tapahtuma 26.-27.9.2017 Messukeskuksessa Helsingissä.

  Not Applicable   $ 8.95

FinnSec 26.-27.9.2017 Messukeskus Helsinki

- finnsec.fi

Pohjoismaiden suurin turvallisuusalan tapahtuma 26.-27.9.2017. Tapahtumassa kohtaavat alan päättäjät ja tekijät sekä yritysten turvallisuudesta vastaavat

  Not Applicable   $ 8.95

Hammaslääkäripäivät | Messukeskus | 24. - 26.11.2016

- hammaslaakaripaivatnayttely.fi

Suomen suurin hammaslääketieteen koulutustapahtuma ja näytttely. Kouluttaudu, kehity ja verkostoidu suun hoidon suurimmassa ammattitapahtumassa.

  Not Applicable   $ 8.95

Studia-messut | Messukeskus | 29. - 30.11.2016

- studiamessut.fi

Suomen suurin opiskelu- ja uratapahtuma Studia. Avoinna ti 29.11. klo 9–17, ke 30.11. klo 9–16. Tervetuloa!

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 09 Apr 2017 14:09:46 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: ; rel=shortlink
X-UA-Compatible: IE=Edge
X-Varnish: 4291614 5784627
Age: 258
Via: 1.1 varnish-v4
X-Cache: cached
Content-Length: 37647
Accept-Ranges: bytes

Domain Information for cybersecuritynordic.com

Domain Registrar: TUCOWS DOMAINS INC.
Registration Date: 2017-02-09 11 months 1 week 4 days ago
Last Modified: 2017-02-09 11 months 1 week 4 days ago
Expiration Date: 2018-02-09 2 weeks 3 days 12 hours from now

Domain Nameserver Information

Host IP Address Country
ns1.mynebula.fi Finland Finland
ns2.mynebula.fi Finland Finland

DNS Record Analysis

Host Type TTL Extra
cybersecuritynordic.com A 3591 IP:
cybersecuritynordic.com NS 3600 Target: ns2.mynebula.fi
cybersecuritynordic.com NS 3600 Target: ns1.mynebula.fi
cybersecuritynordic.com SOA 3600 MNAME: ns1.mynebula.fi
RNAME: hostmaster.mynebula.fi
Serial: 1035000
Refresh: 1800
Retry: 600
Expire: 86400

Similarly Ranked Websites to cybersecuritynordic.com


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 8,833,062,960.00

Google Calendar

- calendar.google.com

With Google's free online calendar, it’s easy to keep track of life’s important events all in one place.

  1   $ 8,833,062,960.00


- mail.google.com

Gmail is email that's intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

  1   $ 8,833,062,960.00

Google Play

- play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

  1   $ 8,833,062,960.00

Chrome Web Browser

- chrome.google.com

A fast, secure, and free web browser built for the modern web. Chrome syncs bookmarks across all your devices, fills out forms automatically, and so much more.

  1   $ 8,833,062,960.00

Competitive search data from SEMrush

cybersecuritynordic.com search engine traffic graph

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup for cybersecuritynordic.com

Whois Server Version 2.0

Domain names in the .com and .net
domains can now be registered
with many different competing
registrars. Go to http://www.internic.net
for detailed

Domain Name:
Sponsoring Registrar IANA ID: 69
Whois Server:
Referral URL:
Name Server: NS1.MYNEBULA.FI
Status: ok
Updated Date: 09-feb-2017
Date: 09-feb-2017
Expiration Date: 09-feb-2018

>>> Last
update of whois database: Sun, 09 Apr 2017 14:14:04 GMT

Like cybersecuritynordic.com ? Comment / rate / feedback below